Jump to content

Alaska Bound


Galway Girl

Recommended Posts

On 7/4/2023 at 12:23 PM, Galway Girl said:

Cheap yoga mats from Amazon.

We cut out templates out of paper grocery bags, then cut mats to fit.

we used 3m no-residue duct tape on edges.

Items are listed on the Amazon Oliver’s Outfitter Guide here:

Is this to protect from rocks and mud?

Oliver Elite II Twin (delivered 3/28/2022)   Tow Vehicle: Chevy Silverado 2500HD diesel "Estrella"

 

 

 

 

2024.04.29 - ALAZARCOFLGAIAKSKYLAMONENMNDOKSDTNTXUTWYBBBBBBsm.jpg

Link to comment
Share on other sites

travel trailer units for sale
Find Oliver Travel Trailers for Sale
New Travel Trailers for Sale
  • Moderators
2 hours ago, Boudicca908 said:

At Denali, I highly recommend the End of the Road bus tour with the guide -- it was one of the highlights of my 3 weeks in Alaska (sans Oliver)... 

 

The best bus tour, if camping, required camping in the furthest out campground (teklanika). Limited facilities,  but great camping, and great tour. 

That tour road is a bit scary, in a big bus, but most of our drivers (hop on/hop off) had been doing it for years. But, lots of wildlife viewing. (The drive out to the cg is quite tame, and very slow.) No private vehicles allowed, so it's just the buses.

Sidebar: My cousin used to walk to work in Denali from outside Cantwell, as a kid. Her dad owned some additional property "way out there," as did  one of his friends .  She told me about driving the scary road home, through the upper park, with her dad, at 17.  In the dark. Those blind curves! And dropoffs.!

 

 

  • Like 1
  • Wow 1

2008 Ram 1500 4 × 4

2008 Oliver Elite, Hull #12

Florida and Western North Carolina, or wherever the truck goes....

400 watts solar. DC compressor fridge. No inverter. 2 x 105 ah agm batteries .  Life is good.


        
 

 

 

Link to comment
Share on other sites

2 hours ago, Boudicca908 said:
On 7/4/2023 at 8:23 AM, Galway Girl said:

 

Is this to protect from rocks and mud?

Yes

  • Like 3

2019 Elite II (Hull 505 - Galway Girl - August 7, 2019 Delivery) 
Tow Vehicle: 2021 F350 King Ranch, FX4, MaxTow Package, 10 Speed, 3.55 Rear Axle
Batteries Upgrade: Dual 315GTX Lithionics Lithiums - 630AH Total
Inverter/Charger: Xantrex 2000Pro 

Travel BLOG:  https://4-ever-hitched.com

 

IMG_5421.jpeg.c1f697a00240a9bd6729b0930bd3a4aa.jpeg

Link to comment
Share on other sites

Made it to Denali NP and Riley Creek CG.

Happy surprise at out AT&T connection speed in the campsite B77.

Two site sizes here when reserving.

A - sites for longer trailers up to 40’

B -sites for <30’ and many double width so truck and trailer are side by side.

Really wide site and quite deep beyond rage rear curb stops.
Setup the clam on the tent pad. 

 

IMG_6911.thumb.jpeg.c9e6d7b39c110921389391e747dfe67d.jpegIMG_2252.thumb.jpeg.3f27fb2c8c91a001db16d9a42b06a954.jpegIMG_2226.thumb.jpeg.45eee926dec7d999e2b31a5976e4c05b.jpegIMG_2217.thumb.jpeg.c13152957ba7952398c62be74968e615.jpegIMG_2227.thumb.jpeg.17ef0fad60212387a7300c64ad290627.jpegIMG_2223.thumb.jpeg.ae343f594e0a9d662b040ea1c58e60b7.jpegIMG_2216.thumb.jpeg.92a5d9f41b42abcf76fcd034b03a9bdf.jpeg

  • Like 5
  • Wow 1

2019 Elite II (Hull 505 - Galway Girl - August 7, 2019 Delivery) 
Tow Vehicle: 2021 F350 King Ranch, FX4, MaxTow Package, 10 Speed, 3.55 Rear Axle
Batteries Upgrade: Dual 315GTX Lithionics Lithiums - 630AH Total
Inverter/Charger: Xantrex 2000Pro 

Travel BLOG:  https://4-ever-hitched.com

 

IMG_5421.jpeg.c1f697a00240a9bd6729b0930bd3a4aa.jpeg

Link to comment
Share on other sites

We are up here too. 
had to go to Whitehorse for some repairs. Depending on how things go we either adjust routes or head home. We will know more in a couple of days. IMG_1843.thumb.jpeg.9d17296bdea95a6123f08cb69616b3eb.jpegIMG_4560.thumb.jpeg.cfd8114a30badbf7c701d53e0e513d83.jpeg

  • Like 7

Maggie & Bryan | Arnegard, ND | 2020 LE II "Twins" Hull #665 | 2021 RAM 2500  6.4L HEMI Gasser  4dr  6.5' bed

ABBCMBNBNTNSONPEQCSKYTALARCTDEFLGAILINIAKSKYLAMEMDMAMIMNMSMONENHNJNYNCNDOHOKPARISCSDTNTXVTVAWVWIxlg.jpg.d41b39fcf844ad1935d35acdc8a6c203.jpg

Link to comment
Share on other sites

  • Moderator+

Great Idea using the tent pad for your clam.

Steve, Tali and our dog Rocky plus our beloved Storm, Lucy, Maggie and Reacher (all waiting at the Rainbow Bridge)

2008 Legacy Elite I - Outlaw Oliver, Hull #026 | 2014 Legacy Elite II - Outlaw Oliver, Hull #050 | 2022 Silverado High Country 3500HD SRW Diesel 4x4 

 

             801469912_StatesVisitedTaliandSteve08-23-2021-I.jpg.26814499292ab76ee55b889b69ad3ef0.jpg1226003278_StatesVisitedTaliandSteve08-23-2021-H.jpg.dc46129cb4967a7fd2531b16699e9e45.jpg

 

 

Link to comment
Share on other sites

On way south from Denali NP today, the “Great One”made a rare clear skies appearance.  Just WOW!

 

IMG_2402.thumb.jpeg.9780d5aeddd66d79b6ce7c95aa90d9e4.jpeg

IMG_2460.thumb.jpeg.13d113da71e893d4f306492698e7905f.jpegIMG_2451.thumb.jpeg.640c7df4c70ce9c728f538d292c3da6b.jpegIMG_2414.thumb.jpeg.80628e2fc0ac612f95b14c4af0af5785.jpegIMG_2407.thumb.jpeg.97d42a5b5523a0d96593da2055c646ae.jpeg

IMG_2397.jpeg

  • Like 3
  • Love 2
  • Wow 1

2019 Elite II (Hull 505 - Galway Girl - August 7, 2019 Delivery) 
Tow Vehicle: 2021 F350 King Ranch, FX4, MaxTow Package, 10 Speed, 3.55 Rear Axle
Batteries Upgrade: Dual 315GTX Lithionics Lithiums - 630AH Total
Inverter/Charger: Xantrex 2000Pro 

Travel BLOG:  https://4-ever-hitched.com

 

IMG_5421.jpeg.c1f697a00240a9bd6729b0930bd3a4aa.jpeg

Link to comment
Share on other sites

  • Moderators

Awesome! I'm so happy for you!

2008 Ram 1500 4 × 4

2008 Oliver Elite, Hull #12

Florida and Western North Carolina, or wherever the truck goes....

400 watts solar. DC compressor fridge. No inverter. 2 x 105 ah agm batteries .  Life is good.


        
 

 

 

Link to comment
Share on other sites

2 hours ago, Galway Girl said:

the “Great One”made a rare clear skies appearance.  Just WOW!

That sums it up! Congrats -- I'm very happy that you were able to see it -- it's glorious and mesmerizing. 

Thank you also for the updated photos of your Oliver and the yoga mat method. Did you do anything for the front of your TV, in similar fashion? 

  • Thanks 1
  • Love 1

Oliver Elite II Twin (delivered 3/28/2022)   Tow Vehicle: Chevy Silverado 2500HD diesel "Estrella"

 

 

 

 

2024.04.29 - ALAZARCOFLGAIAKSKYLAMONENMNDOKSDTNTXUTWYBBBBBBsm.jpg

Link to comment
Share on other sites

  • Moderators

From my cousin's cabin, outside Cantwell,  on good days, we can see Denali. 

I'm so very happy for you. Your photos show a very (unusual) clear sky.

  • Like 1

2008 Ram 1500 4 × 4

2008 Oliver Elite, Hull #12

Florida and Western North Carolina, or wherever the truck goes....

400 watts solar. DC compressor fridge. No inverter. 2 x 105 ah agm batteries .  Life is good.


        
 

 

 

Link to comment
Share on other sites

Homer and Seward checked off.

IMG_2671.thumb.jpeg.987094d127fd1fc02078dfe1ef5fbaeb.jpegIMG_2694.thumb.jpeg.01e18a2c7e7e4212c40bc4b240d4959c.jpegIMG_2705.thumb.jpeg.731764010979e211d80ddf69935faffb.jpegIMG_2721.jpeg.08835ab698e80350fe2a523bbcb0eb91.jpegIMG_2781.thumb.jpeg.3067f046e7af7aa52c89e251ae06e473.jpegIMG_2815.thumb.jpeg.6bad2b0e73d2497aebb8b300c099e239.jpegIMG_2863.thumb.jpeg.63998c6319a2acadfd5371e1d5bfb5fe.jpegIMG_2846.thumb.jpeg.65a6b99cd24ebaaf6b6fa5360c67214a.jpeg

 

  • Like 4
  • Love 1

2019 Elite II (Hull 505 - Galway Girl - August 7, 2019 Delivery) 
Tow Vehicle: 2021 F350 King Ranch, FX4, MaxTow Package, 10 Speed, 3.55 Rear Axle
Batteries Upgrade: Dual 315GTX Lithionics Lithiums - 630AH Total
Inverter/Charger: Xantrex 2000Pro 

Travel BLOG:  https://4-ever-hitched.com

 

IMG_5421.jpeg.c1f697a00240a9bd6729b0930bd3a4aa.jpeg

Link to comment
Share on other sites

1 hour ago, Galway Girl said:

Homer and Seward checked off.

IMG_2671.thumb.jpeg.987094d127fd1fc02078dfe1ef5fbaeb.jpegIMG_2694.thumb.jpeg.01e18a2c7e7e4212c40bc4b240d4959c.jpegIMG_2705.thumb.jpeg.731764010979e211d80ddf69935faffb.jpegIMG_2721.jpeg.08835ab698e80350fe2a523bbcb0eb91.jpegIMG_2781.thumb.jpeg.3067f046e7af7aa52c89e251ae06e473.jpegIMG_2815.thumb.jpeg.6bad2b0e73d2497aebb8b300c099e239.jpegIMG_2863.thumb.jpeg.63998c6319a2acadfd5371e1d5bfb5fe.jpegIMG_2846.thumb.jpeg.65a6b99cd24ebaaf6b6fa5360c67214a.jpeg

 

These are great pictures. I am guessing they are from a camera. What kind-type?

What do you have taped to the front of the Ollie? Are they a rock guard of some sort?

2018 Oliver Elite II, Twin Bed, Hull #354 

2024 RAM 1500, 4 x 4; Gas. 5.7L V8 Hemi MDS VVT Torque; 3.21 rear axle ratio

Maine 

 

Link to comment
Share on other sites

On 7/17/2023 at 11:34 PM, SNY SD UP said:

We are up here too. 
had to go to Whitehorse for some repairs. Depending on how things go we either adjust routes or head home. We will know more in a couple of days. IMG_1843.thumb.jpeg.9d17296bdea95a6123f08cb69616b3eb.jpegIMG_4560.thumb.jpeg.cfd8114a30badbf7c701d53e0e513d83.jpeg

Looks like you brought your Ollie with you to Tuk. How was the roads any concerns towing the Oliver?

Its on our list but wasnt sure about taking the Oliver all the way there or dropping it off in Dawson somewhere.

Vincent, Ohio | 2022 Elite ll, Hull #1182, 2014 Ford F150 3.5L EcoBoost, Max Towing PKG

ALKYMSOHTNWVsm.jpg

Link to comment
Share on other sites

On 7/27/2023 at 1:00 PM, dewdev said:

These are great pictures. I am guessing they are from a camera. What kind-type?

What do you have taped to the front of the Ollie? Are they a rock guard of some sort?

Cameras in use are iPhone 14pro and Fuji XH2.

Front covered using yoga mats and 3m no residue tape (from Amazon)  works great to keep rocks from chipping front.

 

 

  • Like 1

2019 Elite II (Hull 505 - Galway Girl - August 7, 2019 Delivery) 
Tow Vehicle: 2021 F350 King Ranch, FX4, MaxTow Package, 10 Speed, 3.55 Rear Axle
Batteries Upgrade: Dual 315GTX Lithionics Lithiums - 630AH Total
Inverter/Charger: Xantrex 2000Pro 

Travel BLOG:  https://4-ever-hitched.com

 

IMG_5421.jpeg.c1f697a00240a9bd6729b0930bd3a4aa.jpeg

Link to comment
Share on other sites

Roads between Destruction Bay YT and Tok AK are under construction.  Gravel stretches aren’t bad as they are graded. 
worst are long vertical ruts that catch steering Tires.  Need to slow down and plan for a longer drive day.

 

just did the 6  hour  Kenai Fiords NP cruise.  Well worth the prices.

We saw over 20 humpbacks.  One pod of 12 we’re doing bubble feeding where two whales chase the herring into a ball, then three other whales blow bubbles to surround the prey, and then whales come straight up through the bubble pen from the bottom with their mouths wide open , gobbling up everything in their path.  

IMG_2888.jpeg

IMG_2901.jpeg

IMG_2958.jpeg

  • Like 4

2019 Elite II (Hull 505 - Galway Girl - August 7, 2019 Delivery) 
Tow Vehicle: 2021 F350 King Ranch, FX4, MaxTow Package, 10 Speed, 3.55 Rear Axle
Batteries Upgrade: Dual 315GTX Lithionics Lithiums - 630AH Total
Inverter/Charger: Xantrex 2000Pro 

Travel BLOG:  https://4-ever-hitched.com

 

IMG_5421.jpeg.c1f697a00240a9bd6729b0930bd3a4aa.jpeg

Link to comment
Share on other sites

  • 3 weeks later...

Made it home from the Alaska trip.

The yoga mat's worked really well keeping away rock chips. (Thanks for the ideas from previous owners).

The 3M no-residue tape was also a godsend...it peeled off without any issues.

We saw 3 other Oliver's out on this trip.  All of them had some type of front covering.
One person used very flexible linoleum flooring they picked up in Whitehorse YT.

 

Dirty trailer and beat up yoga mats upon arrival home:

image.thumb.jpeg.fd5373926ffa5ca9fe26fbe744689c95.jpeg

After stripping off yoga mats and a quick wash:

image.thumb.jpeg.c6be5697ae6a3e4c3bae525f4ddc40ab.jpeg

  • Like 5

2019 Elite II (Hull 505 - Galway Girl - August 7, 2019 Delivery) 
Tow Vehicle: 2021 F350 King Ranch, FX4, MaxTow Package, 10 Speed, 3.55 Rear Axle
Batteries Upgrade: Dual 315GTX Lithionics Lithiums - 630AH Total
Inverter/Charger: Xantrex 2000Pro 

Travel BLOG:  https://4-ever-hitched.com

 

IMG_5421.jpeg.c1f697a00240a9bd6729b0930bd3a4aa.jpeg

Link to comment
Share on other sites

Create an account or sign in to comment

You need to be a member in order to leave a comment

Create an account

Sign up for a new account in our community. It's easy!

Register a new account

Sign in

Already have an account? Sign in here.

Sign In Now
×
×
  • Create New...